SENP8 (NM_145204) Human Mass Spec Standard

CAT#: PH306791

SENP8 MS Standard C13 and N15-labeled recombinant protein (NP_660205)

Product Images

Coomassie blue staining of purified SENP8 protein (Cat# TP306791). The protein was produced from HEK293T cells transfected with SENP8 cDNA clone (Cat# RC206791) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206791
• Predicted MW: 24.1 kDa
• Protein Sequence:
  Sequence Link

  >RC206791 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE
  IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL
  GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLA
  KK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660205
• RefSeq Size: 1569
• RefSeq ORF: 636
• Synonyms: DEN1; NEDP1; PRSC2
• Locus ID: 123228
• UniProt ID: Q96LD8, A8K8D3
• Cytogenetics: 15q23
• Summary: This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
• Protein Families: Druggable Genome, Protease