Germany
Japan
United Kingdom
China
TAFA4 (NM_182522) Human Mass Spec Standard
CAT#: PH306792
FAM19A4 MS Standard C13 and N15-labeled recombinant protein (NP_872328)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206792 |
| Predicted MW | 15.7 kDa |
| Protein Sequence |
>RC206792 protein sequence
Red=Cloning site Green=Tags(s) MRSPRMRVCAKSVLLSHWLFLAYVLMVCCKLMSASSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEER SQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_872328 |
| RefSeq Size | 2294 |
| RefSeq ORF | 420 |
| Synonyms | FAM19A4; TAFA-4 |
| Locus ID | 151647 |
| UniProt ID | Q96LR4, A0A024R369 |
| Cytogenetics | 3p14.1 |
| Summary | This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Nov 2011] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403635 | FAM19A4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423625 | FAM19A4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403635 | Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 1 |
USD 396.00 |
|
| LY423625 | Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 2 |
USD 396.00 |
|
| TP306792 | Recombinant protein of human family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 1 |
USD 823.00 |
|
| TP721173 | Purified recombinant protein of Human family with sequence similarity 19 (chemokine (C-C motif)-like), member A4 (FAM19A4), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review