Rabbit Polyclonal Anti-Fam19a4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Fam19a4 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Fam19a4. Synthetic peptide located within the following region: VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEA |
Rabbit Polyclonal Anti-FAM19A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM19A4 Antibody: synthetic peptide directed towards the middle region of human FAM19A4. Synthetic peptide located within the following region: SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVA |
TAFA4 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TAFA4 |
Germany
Japan
United Kingdom
China
