TAFA4 Rabbit Polyclonal Antibody

CAT#: TA335352

Rabbit Polyclonal Anti-Fam19a4 Antibody

Product Images

WB Suggested Anti-Fam19a4 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fam19a4 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Fam19a4. Synthetic peptide located within the following region: VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: family with sequence similarity 19 member A4, C-C motif chemokine like
• Database Link:
  NP_872328
  Entrez Gene 689043 Rat
  UniProt ID Q96LR4
• Background: The function of this protein remains unknown.
• Synonyms: TAFA-4; TAFA4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Families: Secreted Protein, Transmembrane