HPD (NM_002150) Human Mass Spec Standard
CAT#: PH306860
HPD MS Standard C13 and N15-labeled recombinant protein (NP_002141)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206860 |
Predicted MW | 44.9 kDa |
Protein Sequence |
>RC206860 protein sequence
Red=Cloning site Green=Tags(s) MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFV LSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYG DTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFW SVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEV IQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002141 |
RefSeq Size | 1440 |
RefSeq ORF | 1179 |
Synonyms | 4-HPPD; 4HPPD; GLOD3; HPPDASE; PPD |
Locus ID | 3242 |
UniProt ID | P32754 |
Cytogenetics | 12q24.31 |
Summary | 'The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria (HAWK). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]' |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism, Ubiquinone and other terpenoid-quinone biosynthesis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419503 | HPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC432928 | HPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419503 | Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1 |
USD 325.00 |
|
LY432928 | Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2 |
USD 325.00 |
|
TP306860 | Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD) |
USD 823.00 |
|
TP720550 | Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2. |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review