HPD (NM_002150) Human Mass Spec Standard

CAT#: PH306860

HPD MS Standard C13 and N15-labeled recombinant protein (NP_002141)

Product Images

Coomassie blue staining of purified HPD protein (Cat# TP306860). The protein was produced from HEK293T cells transfected with HPD cDNA clone (Cat# RC206860) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206860
• Predicted MW: 44.9 kDa
• Protein Sequence:
  Sequence Link

  >RC206860 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFV
  LSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYG
  DTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFW
  SVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH
  LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEV
  IQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002141
• RefSeq Size: 1440
• RefSeq ORF: 1179
• Synonyms: 4-HPPD; 4HPPD; GLOD3; HPPDASE; PPD
• Locus ID: 3242
• UniProt ID: P32754
• Cytogenetics: 12q24.31
• Summary: 'The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria (HAWK). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism, Ubiquinone and other terpenoid-quinone biosynthesis