DNTTIP1 (NM_052951) Human Mass Spec Standard

CAT#: PH306867

DNTTIP1 MS Standard C13 and N15-labeled recombinant protein (NP_443183)

Product Images

Coomassie blue staining of purified DNTTIP1 protein (Cat# TP306867). The protein was produced from HEK293T cells transfected with DNTTIP1 cDNA clone (Cat# RC206867) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206867
• Predicted MW: 36.8 kDa
• Protein Sequence:
  Sequence Link

  >RC206867 representing NM_052951
  Red=Cloning site Green=Tags(s)
  
  MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSFTDPAISMDLL
  RAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLT
  HELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGPKWDPARLNES
  TTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAAS
  DDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETLRTENEHRAVEAPPQT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443183
• RefSeq Size: 1317
• RefSeq ORF: 987
• Synonyms: C20orf167; dJ447F3.4; Tdif1
• Locus ID: 116092
• UniProt ID: Q9H147
• Cytogenetics: 20q13.12
• Summary: DNTTIP1 binds DNA and enhances the activity of terminal deoxynucleotidyltransferase (TDT, or DNTT; MIM 187410), a DNA polymerase that catalyzes the polymerization of DNA in the absence of a DNA template (Yamashita et al., 2001 [PubMed 11473582]). [supplied by OMIM, Mar 2008]