CD94 (KLRD1) (NM_002262) Human Mass Spec Standard

CAT#: PH306991

KLRD1 MS Standard C13 and N15-labeled recombinant protein (NP_002253)

Product Images

Coomassie blue staining of purified KLRD1 protein (Cat# TP306991). The protein was produced from HEK293T cells transfected with KLRD1 cDNA clone (Cat# RC206991) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206991
• Predicted MW: 20.5 kDa
• Protein Sequence:
  Sequence Link

  >RC206991 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRC
  NCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYL
  FPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002253
• RefSeq Size: 3258
• RefSeq ORF: 537
• Synonyms: CD94
• Locus ID: 3824
• UniProt ID: Q13241, Q53ZY6
• Cytogenetics: 12p13.2
• Summary: 'Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2017]'
• Protein Families: Transmembrane
• Protein Pathways: Antigen processing and presentation, Graft-versus-host disease, Natural killer cell mediated cytotoxicity