Cardiac Troponin I (TNNC1) (NM_003280) Human Mass Spec Standard

CAT#: PH307014

TNNC1 MS Standard C13 and N15-labeled recombinant protein (NP_003271)

Product Images

Coomassie blue staining of purified TNNC1 protein (Cat# TP307014). The protein was produced from HEK293T cells transfected with TNNC1 cDNA clone (Cat# RC207014) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207014
• Predicted MW: 18.4 kDa
• Protein Sequence:
  Sequence Link

  >RC207014 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSG
  TVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDG
  DKNNDGRIDYDEFLEFMKGVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003271
• RefSeq Size: 705
• RefSeq ORF: 483
• Synonyms: CMD1Z; CMH13; TN-C; TNC; TNNC
• Locus ID: 7134
• UniProt ID: P63316, Q6FH91
• Cytogenetics: 3p21.1
• Summary: 'Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq, Oct 2008]'
• Protein Pathways: Calcium signaling pathway, Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)