Cardiac Troponin I (TNNC1) (NM_003280) Human Recombinant Protein

CAT#: TP307014

Recombinant protein of human troponin C type 1 (slow) (TNNC1)

Product Images

Coomassie blue staining of purified TNNC1 protein (Cat# TP307014). The protein was produced from HEK293T cells transfected with TNNC1 cDNA clone (Cat# RC207014) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207014 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSG
  TVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDG
  DKNNDGRIDYDEFLEFMKGVE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003271
• Locus ID: 7134
• UniProt ID: P63316, Q6FH91
• Cytogenetics: 3p21.1
• Refseq Size: 705
• Refseq ORF: 483
• Synonyms: CMD1Z; CMH13; TN-C; TNC; TNNC
• Summary: Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z. [provided by RefSeq, Oct 2008]
• Protein Pathways: Calcium signaling pathway, Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)