CSRP1 (NM_004078) Human Mass Spec Standard

CAT#: PH307109

CSRP1 MS Standard C13 and N15-labeled recombinant protein (NP_004069)

Product Images

Coomassie blue staining of purified CSRP1 protein (Cat# TP307109). The protein was produced from HEK293T cells transfected with CSRP1 cDNA clone (Cat# RC207109) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207109
• Predicted MW: 20.6 kDa
• Protein Sequence:
  Sequence Link

  >RC207109 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKG
  YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWH
  KACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004069
• RefSeq Size: 1970
• RefSeq ORF: 579
• Synonyms: CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286
• Locus ID: 1465
• UniProt ID: P21291, A0A384P5K2
• Cytogenetics: 1q32.1
• Summary: 'This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]'