ACYP1 (NM_001107) Human Mass Spec Standard

CAT#: PH307110

ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098)

Product Images

Coomassie blue staining of purified ACYP1 protein (Cat# TP307110). The protein was produced from HEK293T cells transfected with ACYP1 cDNA clone (Cat# RC207110) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207110
• Predicted MW: 11.3 kDa
• Protein Sequence:
  Sequence Link

  >RC207110 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG
  SPKSHIDKANFNNEKVILKLDYSDFQIVK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001098
• RefSeq Size: 621
• RefSeq ORF: 297
• Synonyms: ACYPE
• Locus ID: 97
• UniProt ID: P07311
• Cytogenetics: 14q24.3
• Summary: This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
• Protein Pathways: Pyruvate metabolism