Glycerol kinase (GK) (NM_203391) Human Mass Spec Standard

CAT#: PH307264

GK MS Standard C13 and N15-labeled recombinant protein (NP_976325)

Product Images

Coomassie blue staining of purified GK protein (Cat# TP307264). The protein was produced from HEK293T cells transfected with GK cDNA clone (Cat# RC207264) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207264
• Predicted MW: 58.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207264 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEK
  TCEKLGQLKIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRITGNNNFVKSK
  TGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNI
  HSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKISHSVKAGALEGVPISGCLGDQSAALVGQMCFQIGQ
  AKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEE
  IEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
  CGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTM
  ERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_976325
• RefSeq Size: 4503
• RefSeq ORF: 1590
• Synonyms: GK1; GKD
• Locus ID: 2710
• UniProt ID: P32189, B4DH54
• Cytogenetics: Xp21.2
• Summary: 'The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]'
• Protein Families: Druggable Genome
• Protein Pathways: Glycerolipid metabolism, Metabolic pathways, PPAR signaling pathway