KIAA1576 (VAT1L) (NM_020927) Human Mass Spec Standard

CAT#: PH307266

VAT1L MS Standard C13 and N15-labeled recombinant protein (NP_065978)

Product Images

Coomassie blue staining of purified VAT1L protein (Cat# TP307266). The protein was produced from HEK293T cells transfected with VAT1L cDNA clone (Cat# RC207266) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207266
• Predicted MW: 45.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207266 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAKEGVEKAEETEQMIEKEAGKEPAEGGGGDGSHRLGDAQEMRAVVLAGFGGLNKLRLFRKAMPEPQDGE
  LKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVC
  TPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANLREGMSVLVHSAGGGVGQAVAQLCSTVPNVTVF
  GTASTFKHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNM
  VTGETKSFFSFAKSWWQVEKVNPIKLYEENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKKIKPV
  VDSLWALEEVKEAMQRIHDRGNIGKLILDVEKTPTPLMANDSTETSEAGEEEEDHEGDSENKERMPFIQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065978
• RefSeq Size: 3784
• RefSeq ORF: 1257
• Synonyms: KIAA1576
• Locus ID: 57687
• UniProt ID: Q9HCJ6, A8K288
• Cytogenetics: 16q23.1
• Summary: Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome