Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-VAT1L Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Vat1l antibody is: synthetic peptide directed towards the N-terminal region of Vat1l. Synthetic peptide located within the following region: FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN |
Carrier-free (BSA/glycerol-free) VAT1L mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
VAT1L Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human VAT1L |
USD 420.00
4 Weeks
Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |