MRCL3 (MYL12A) (NM_006471) Human Mass Spec Standard

CAT#: PH307294

MYL12A MS Standard C13 and N15-labeled recombinant protein (NP_006462)

Product Images

Coomassie blue staining of purified MYL12A protein (Cat# TP307294). The protein was produced from HEK293T cells transfected with MYL12A cDNA clone (Cat# RC207294) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207294
• Predicted MW: 19.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207294 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLD
  AMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE
  LYREAPIDKKGNFNYIEFTRILKHGAKDKDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006462
• RefSeq Size: 1243
• RefSeq ORF: 513
• Synonyms: HEL-S-24; MLC-2B; MLCB; MRCL3; MRLC3; MYL2B
• Locus ID: 10627
• UniProt ID: P19105
• Cytogenetics: 18p11.31
• Summary: This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8. [provided by RefSeq, Dec 2014]
• Protein Pathways: Focal adhesion, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction