TEKT2 (NM_014466) Human Mass Spec Standard

CAT#: PH307425

TEKT2 MS Standard C13 and N15-labeled recombinant protein (NP_055281)

Product Images

Coomassie blue staining of purified TEKT2 protein (Cat# TP307425). The protein was produced from HEK293T cells transfected with TEKT2 cDNA clone (Cat# RC207425) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207425
• Predicted MW: 49.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207425 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDT
  VNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKE
  VEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPD
  GSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELK
  WQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIA
  ALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLTVPAERFVPEVDTFTRTTNSTLS
  PLKSCQLELA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055281
• RefSeq Size: 1536
• RefSeq ORF: 1290
• Synonyms: h-tektin-t; TEKTB1; TEKTIN-T
• Locus ID: 27285
• UniProt ID: Q9UIF3
• Cytogenetics: 1p34.3
• Summary: This gene product belongs to the tektin family of proteins. Tektins comprise a family of filament-forming proteins that are coassembled with tubulins to form ciliary and flagellar microtubules. This gene is expressed in the testis and its protein is localized to the flagella of the sperms, indicating that it may play a role in spermatogenesis. [provided by RefSeq, Jul 2008]