TAF7 (NM_005642) Human Mass Spec Standard

CAT#: PH307437

TAF7 MS Standard C13 and N15-labeled recombinant protein (NP_005633)

Product Images

Coomassie blue staining of purified TAF7 protein (Cat# TP307437). The protein was produced from HEK293T cells transfected with TAF7 cDNA clone (Cat# RC207437) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207437
• Predicted MW: 40.3 kDa
• Protein Sequence:
  Sequence Link

  >RC207437 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDL
  PCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPL
  KNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQG
  HDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMG
  IQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005633
• RefSeq Size: 2310
• RefSeq ORF: 1047
• Synonyms: TAF2F; TAFII55
• Locus ID: 6879
• UniProt ID: Q15545
• Cytogenetics: 5q31.3
• Summary: 'The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors
• Protein Pathways: Basal transcription factors