Tspan 13 (TSPAN13) (NM_014399) Human Mass Spec Standard

CAT#: PH307535

TSPAN13 MS Standard C13 and N15-labeled recombinant protein (NP_055214)

Product Images

Coomassie blue staining of purified TSPAN13 protein (Cat# TP307535). The protein was produced from HEK293T cells transfected with TSPAN13 cDNA clone (Cat# RC207535) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207535
• Predicted MW: 22.1 kDa
• Protein Sequence:
  Sequence Link

  >RC207535 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKH
  HQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTC
  LASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055214
• RefSeq Size: 1912
• RefSeq ORF: 612
• Synonyms: NET-6; NET6; TM4SF13
• Locus ID: 27075
• UniProt ID: O95857, Q6FGK0
• Cytogenetics: 7p21.1
• Summary: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane