CNOT4 (NM_001008225) Human Mass Spec Standard
CAT#: PH307541
CNOT4 MS Standard C13 and N15-labeled recombinant protein (NP_001008226)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207541 |
Predicted MW | 63.1 kDa |
Protein Sequence |
>RC207541 protein sequence
Red=Cloning site Green=Tags(s) MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSL SIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPP FPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKEL SVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPG QAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQ GQQPTSLHTTVA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001008226 |
RefSeq Size | 3774 |
RefSeq ORF | 1716 |
Synonyms | CLONE243; NOT4; NOT4H |
Locus ID | 4850 |
UniProt ID | O95628, A0A024R776 |
Cytogenetics | 7q33 |
Summary | 'The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | RNA degradation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415669 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC423402 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC434319 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415669 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1 |
USD 495.00 |
|
LY423402 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2 |
USD 325.00 |
|
LY434319 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 4 |
USD 325.00 |
|
TP307541 | Recombinant protein of human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2 |
USD 867.00 |
|
TP762054 | Purified recombinant protein of Human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1,Leu190-Ala455, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review