CNOT4 (NM_001008225) Human Recombinant Protein
CAT#: TP307541
Recombinant protein of human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207541 protein sequence
Red=Cloning site Green=Tags(s) MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSL SIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPP FPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKEL SVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPG QAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQ GQQPTSLHTTVA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 62.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008226 |
Locus ID | 4850 |
UniProt ID | O95628, A0A024R776 |
Cytogenetics | 7q33 |
Refseq Size | 3774 |
Refseq ORF | 1716 |
Synonyms | CLONE243; NOT4; NOT4H |
Summary | The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415669 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC423402 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC434319 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415669 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1 |
USD 495.00 |
|
LY423402 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2 |
USD 325.00 |
|
LY434319 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 4 |
USD 325.00 |
|
PH307541 | CNOT4 MS Standard C13 and N15-labeled recombinant protein (NP_001008226) |
USD 2,055.00 |
|
TP762054 | Purified recombinant protein of Human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1,Leu190-Ala455, with N-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review