Calcium independent Phospholipase A2 (PLA2G6) (NM_003560) Human Mass Spec Standard
CAT#: PH307546
PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_003551)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207546 |
Predicted MW | 89.7 kDa |
Protein Sequence |
>RC207546 representing NM_003560
Red=Cloning site Green=Tags(s) MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFR LFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRI ISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAV AGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIH SKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHG NTPLHLAMSKDNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRLVTRKAILTLLRTVGAEYCFPPIHG VPAEQGSAAPHHPFSLERAQPPPISLNNLELQDLMHISRARKPAFILGSMRDEKRTHDHLLCLDGGGVKG LIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPL EEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLV WRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQ VPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIML DEVSDTVLVNALWETEVYIYEHREEFQKLIQLLLSP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003551 |
RefSeq Size | 3239 |
RefSeq ORF | 2418 |
Synonyms | CaI-PLA2; GVI; INAD1; iPLA2; IPLA2-VIA; iPLA2beta; NBIA2; NBIA2A; NBIA2B; PARK14; PLA2; PNPLA9 |
Locus ID | 8398 |
UniProt ID | O60733 |
Cytogenetics | 22q13.1 |
Summary | The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date. [provided by RefSeq, Dec 2010] |
Protein Pathways | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400377 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418601 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429150 | PLA2G6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400377 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2 |
USD 396.00 |
|
LY418601 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1 |
USD 396.00 |
|
LY429150 | Transient overexpression lysate of phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1 |
USD 605.00 |
|
PH308735 | PLA2G6 MS Standard C13 and N15-labeled recombinant protein (NP_001004426) |
USD 2,055.00 |
|
TP307546 | Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 1 |
USD 867.00 |
|
TP308735 | Recombinant protein of human phospholipase A2, group VI (cytosolic, calcium-independent) (PLA2G6), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review