PNK (PNKP) (NM_007254) Human Mass Spec Standard

CAT#: PH307551

PNKP MS Standard C13 and N15-labeled recombinant protein (NP_009185)

Product Images

Coomassie blue staining of purified PNKP protein (Cat# TP307551). The protein was produced from HEK293T cells transfected with PNKP cDNA clone (Cat# RC207551) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207551
• Predicted MW: 57.1 kDa
• Protein Sequence:
  Sequence Link

  >RC207551 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVN
  PSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRM
  RKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEG
  YKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPIS
  IGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSG
  PLCLPESRALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVA
  IDNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPT
  LAEGFSAILEIPFRLWVEPRLGRLYCQFSEG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009185
• RefSeq Size: 1721
• RefSeq ORF: 1563
• Synonyms: AOA4; EIEE10; MCSZ; PNK
• Locus ID: 11284
• UniProt ID: Q96T60
• Cytogenetics: 19q13.33
• Summary: This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5' phosphorylation and 3' dephosphorylation of nucleic acids. Mutations at this locus have been associated with microcephaly, seizures, and developmental delay. [provided by RefSeq, Sep 2010]
• Protein Families: Druggable Genome, Phosphatase