TFF1 (NM_003225) Human Mass Spec Standard
CAT#: PH307599
TFF1 MS Standard C13 and N15-labeled recombinant protein (NP_003216)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207599 |
| Predicted MW | 9.15 kDa |
| Protein Sequence |
>RC207599 representing NM_003225
Red=Cloning site Green=Tags(s) MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY PNTIDVPPEEECEF myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003216 |
| RefSeq Size | 508 |
| RefSeq ORF | 252 |
| Synonyms | BCEI; D21S21; HP1.A; HPS2; pNR-2; pS2 |
| Locus ID | 7031 |
| UniProt ID | P04155 |
| Cytogenetics | 21q22.3 |
| Summary | 'Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418822 | TFF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418822 | Transient overexpression lysate of trefoil factor 1 (TFF1) |
USD 436.00 |
|
| TP307599 | Purified recombinant protein of Homo sapiens trefoil factor 1 (TFF1) |
USD 439.00 |
|
| TP723434 | Purified recombinant protein of Human trefoil factor 1 (TFF1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China