C4orf33 (NM_173487) Human Mass Spec Standard
CAT#: PH307633
C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_775758)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207633 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC207633 protein sequence
Red=Cloning site Green=Tags(s) MDFKIEHTWDGFPVKHEPVFIRLNPGDRGVMMDISAPFFRDPPAPLGEPGKPFNELWDYEVVEAFFLNDI TEQYLEVELCPHGQHLVLLLSGRRNVWKQELPLSFRVSRGETKWEGKAYLPWSYFPPNVTKFNSFAIHGS KDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNFNTLLGEEWKQPESDLWLIEKCDI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_775758 |
RefSeq Size | 1873 |
RefSeq ORF | 597 |
Synonyms | FLJ33703 |
Locus ID | 132321 |
UniProt ID | Q8N1A6 |
Cytogenetics | 4q28.2 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406603 | C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420533 | C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426087 | C4orf33 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406603 | Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 1 |
USD 396.00 |
|
LY420533 | Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 2 |
USD 396.00 |
|
LY426087 | Transient overexpression lysate of chromosome 4 open reading frame 33 (C4orf33), transcript variant 2 |
USD 396.00 |
|
PH316543 | C4orf33 MS Standard C13 and N15-labeled recombinant protein (NP_001093253) |
USD 2,055.00 |
|
TP307633 | Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 1 |
USD 823.00 |
|
TP316543 | Recombinant protein of human chromosome 4 open reading frame 33 (C4orf33), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review