FAM24B (NM_152644) Human Mass Spec Standard
CAT#: PH307710
FAM24B MS Standard C13 and N15-labeled recombinant protein (NP_689857)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207710 |
Predicted MW | 10.2 kDa |
Protein Sequence |
>RC207710 protein sequence
Red=Cloning site Green=Tags(s) MLVIAGGILAALLLLIVVVLCLYFKIHNALKAAKEPEAVAVKNHNPDKVWWAKNSQAKTIATESCPALQC CEGYRMCASFDSLPPCCCDINEGL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_689857 |
RefSeq Size | 788 |
RefSeq ORF | 282 |
Synonyms | DKFZp667I0323; MGC45962 |
Locus ID | 196792 |
UniProt ID | Q8N5W8 |
Cytogenetics | 10q26.13 |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403479 | FAM24B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403479 | Transient overexpression lysate of family with sequence similarity 24, member B (FAM24B) |
USD 396.00 |
|
TP307710 | Recombinant protein of human family with sequence similarity 24, member B (FAM24B) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review