KCTD10 (NM_031954) Human Mass Spec Standard

CAT#: PH307723

KCTD10 MS Standard C13 and N15-labeled recombinant protein (NP_114160)

Product Images

Coomassie blue staining of purified KCTD10 protein (Cat# TP307723). The protein was produced from HEK293T cells transfected with KCTD10 cDNA clone (Cat# RC207723) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207723
• Predicted MW: 35.4 kDa
• Protein Sequence:
  Sequence Link

  >RC207723 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVLTD
  SEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQNKDTYEPFCKV
  PVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVIGDE
  ICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAG
  RSHHLDEDEERERIERVRRIHIKRPDDRAHLHQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114160
• RefSeq Size: 4057
• RefSeq ORF: 939
• Synonyms: BTBD28; hBACURD3; MSTP028; ULRO61
• Locus ID: 83892
• UniProt ID: Q9H3F6, A0A024RBJ2
• Cytogenetics: 12q24.11
• Summary: The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]
• Protein Families: Ion Channels: Other