NUDT12 (NM_031438) Human Mass Spec Standard

CAT#: PH307724

NUDT12 MS Standard C13 and N15-labeled recombinant protein (NP_113626)

Product Images

Coomassie blue staining of purified NUDT12 protein (Cat# TP307724). The protein was produced from HEK293T cells transfected with NUDT12 cDNA clone (Cat# RC207724) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207724
• Predicted MW: 52.1 kDa
• Protein Sequence:
  Sequence Link

  >RC207724 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPEIVQFLLEKGC
  DRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLL
  AKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLGVELEIKDKLL
  NYAGEVPREEEDGLVAWFALGIDPIAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSR
  YKFCPTCGNATKIEEGGYKRLCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMF
  TCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
  WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_113626
• RefSeq Size: 3514
• RefSeq ORF: 1386
• Synonyms: DKFZp761I172
• Locus ID: 83594
• UniProt ID: Q9BQG2
• Cytogenetics: 5q21.2
• Summary: Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]). [supplied by OMIM, Mar 2008]
• Protein Pathways: Nicotinate and nicotinamide metabolism