NUDT12 (NM_031438) Human Recombinant Protein

CAT#: TP307724

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 12 (NUDT12)

Product Images

Coomassie blue staining of purified NUDT12 protein (Cat# TP307724). The protein was produced from HEK293T cells transfected with NUDT12 cDNA clone (Cat# RC207724) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207724 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSVKRSLKQEIVTQFHCSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPEIVQFLLEKGC
  DRSIVNKSRQTALDIAVFWGYKHIANLLATAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDWLL
  AKESHPATVFILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIFLGVELEIKDKLL
  NYAGEVPREEEDGLVAWFALGIDPIAAEEFKQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSR
  YKFCPTCGNATKIEEGGYKRLCLKEDCPSLNGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMF
  TCLAGFIEPGETIEDAVRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDAR
  WFTREQVLDVLTKGKQQAFFVPPSRAIAHQLIKHWIRINPNL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 51.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_113626
• Locus ID: 83594
• UniProt ID: Q9BQG2
• Cytogenetics: 5q21.2
• Refseq Size: 3514
• Refseq ORF: 1386
• Summary: Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]).[supplied by OMIM, Mar 2008]
• Protein Pathways: Nicotinate and nicotinamide metabolism