TXNDC3 (NME8) (NM_016616) Human Mass Spec Standard

CAT#: PH307744

TXNDC3 MS Standard C13 and N15-labeled recombinant protein (NP_057700)

Product Images

Coomassie blue staining of purified NME8 protein (Cat# TP307744). The protein was produced from HEK293T cells transfected with NME8 cDNA clone (Cat# RC207744) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207744
• Predicted MW: 67.3 kDa
• Protein Sequence:
  Sequence Link

  >RC207744 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEAD
  NIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVDSDS
  EVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQRDF
  EEFVSFMTSGLSYILVVSQGSKHNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLER
  QHLAQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQ
  VVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQ
  FAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTP
  EQTEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISK
  LKNIVHGASNAYEAKEVVNRLFEDPEEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057700
• RefSeq Size: 2327
• RefSeq ORF: 1764
• Synonyms: CILD6; HEL-S-99; NM23-H8; sptrx-2; SPTRX2; TXNDC3
• Locus ID: 51314
• UniProt ID: Q8N427
• Cytogenetics: 7p14.1
• Summary: This gene encodes a protein with an N-terminal thioredoxin domain and three C-terminal nucleoside diphosphate kinase (NDK) domains, but the NDK domains are thought to be catalytically inactive. The sea urchin ortholog of this gene encodes a component of sperm outer dynein arms, and the protein is implicated in ciliary function. Mutations in this gene are implicated in primary ciliary dyskinesia type 6. [provided by RefSeq, Nov 2009]
• Protein Families: Druggable Genome