Brk (PTK6) (NM_005975) Human Mass Spec Standard

CAT#: PH307766

PTK6 MS Standard C13 and N15-labeled recombinant protein (NP_005966)

Product Images

Coomassie blue staining of purified PTK6 protein (Cat# TP307766). The protein was produced from HEK293T cells transfected with PTK6 cDNA clone (Cat# RC207766) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207766
• Predicted MW: 51.7 kDa
• Protein Sequence:
  Sequence Link

  >RC207766 representing NM_005975
  Red=Cloning site Green=Tags(s)
  
  MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQGYVPHNYLAER
  ETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLN
  EAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSGYFGEVFEGLW
  KDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSD
  EKVLPVSELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIP
  YKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
  LTCWCRDPEQRPCFKALRERLSSFTSYENPT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005966
• RefSeq Size: 2519
• RefSeq ORF: 1353
• Synonyms: BRK
• Locus ID: 5753
• UniProt ID: Q13882
• Cytogenetics: 20q13.33
• Summary: 'The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epidermal growth factor and results in a partially transformed phenotype. Expression of this gene has been detected at low levels in some breast tumors but not in normal breast tissue. The encoded protein has been shown to undergo autophosphorylation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]'
• Protein Families: Druggable Genome, Protein Kinase, Secreted Protein