PRKAR1B (NM_002735) Human Mass Spec Standard

CAT#: PH307809

PRKAR1B MS Standard C13 and N15-labeled recombinant protein (NP_002726)

Product Images

Coomassie blue staining of purified PRKAR1B protein (Cat# TP307809). The protein was produced from HEK293T cells transfected with PRKAR1B cDNA clone (Cat# RC207809) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207809
• Predicted MW: 43.1 kDa
• Protein Sequence:
  Sequence Link

  >RC207809 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQK
  SNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAH
  LDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTP
  RAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGE
  KIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKL
  DRPRFERVLGPCSEILKRNIQRYNSFISLTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002726
• RefSeq Size: 2512
• RefSeq ORF: 1143
• Synonyms: PRKAR1
• Locus ID: 5575
• UniProt ID: P31321
• Cytogenetics: 7p22.3
• Summary: 'The protein encoded by this gene is a regulatory subunit of cyclic AMP-dependent protein kinase A (PKA), which is involved in the signaling pathway of the second messenger cAMP. Two regulatory and two catalytic subunits form the PKA holoenzyme, disbands after cAMP binding. The holoenzyme is involved in many cellular events, including ion transport, metabolism, and transcription. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2015]'
• Protein Families: Druggable Genome
• Protein Pathways: Apoptosis, Insulin signaling pathway