BMAL1 (ARNTL) (NM_001178) Human Mass Spec Standard
CAT#: PH307870
ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001169)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207870 |
Predicted MW | 68.7 kDa |
Protein Sequence |
>RC207870 protein sequence
Red=Cloning site Green=Tags(s) MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCT IHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFV FVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWF SFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAG AGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQEN PGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001169 |
RefSeq Size | 2863 |
RefSeq ORF | 1875 |
Synonyms | bHLHe5; BMAL1; BMAL1c; JAP3; MOP3; PASD3; TIC |
Locus ID | 406 |
UniProt ID | O00327, A0A140VKD3 |
Cytogenetics | 11p15.3 |
Summary | 'The protein encoded by this gene is a basic helix-loop-helix protein that forms a heterodimer with CLOCK. This heterodimer binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Defects in this gene have been linked to infertility, problems with gluconeogenesis and lipogenesis, and altered sleep patterns. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]' |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Circadian rhythm - mammal |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400474 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422246 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC422247 | ARNTL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400474 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1 |
USD 396.00 |
|
LY422246 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2 |
USD 605.00 |
|
LY422247 | Transient overexpression lysate of aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3 |
USD 396.00 |
|
PH304464 | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025444) |
USD 2,055.00 |
|
PH317474 | ARNTL MS Standard C13 and N15-labeled recombinant protein (NP_001025443) |
USD 2,055.00 |
|
TP304464 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 3 |
USD 867.00 |
|
TP307870 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 1 |
USD 823.00 |
|
TP317474 | Recombinant protein of human aryl hydrocarbon receptor nuclear translocator-like (ARNTL), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review