PDSS2 (NM_020381) Human Mass Spec Standard

CAT#: PH307892

PDSS2 MS Standard C13 and N15-labeled recombinant protein (NP_065114)

Product Images

Coomassie blue staining of purified PDSS2 protein (Cat# TP307892). The protein was produced from HEK293T cells transfected with PDSS2 cDNA clone (Cat# RC207892) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207892
• Predicted MW: 44.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207892 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLR
  CLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSG
  IYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK
  VVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMA
  FQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIREAQEKGRLDYAKLRE
  RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065114
• RefSeq Size: 3568
• RefSeq ORF: 1197
• Synonyms: bA59I9.3; C6orf210; COQ1B; COQ10D3; DLP1; hDLP1
• Locus ID: 57107
• UniProt ID: Q86YH6
• Cytogenetics: 6q21
• Summary: The protein encoded by this gene is an enzyme that synthesizes the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. Defects in this gene are a cause of coenzyme Q10 deficiency. [provided by RefSeq, Oct 2009]
• Protein Pathways: Terpenoid backbone biosynthesis