PDSS2 (NM_020381) Human Recombinant Protein
CAT#: TP307892
Recombinant protein of human prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207892 protein sequence
Red=Cloning site Green=Tags(s) MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIVGYPTSFMSLR CLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLISKAAGPSSVNTSCQNYDMVSG IYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK VVELLASALMDLVQGVYHENSTSKESYITDDIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMA FQYGKHMAMSHKINSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIREAQEKGRLDYAKLRE RIKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065114 |
Locus ID | 57107 |
UniProt ID | Q86YH6 |
Cytogenetics | 6q21 |
Refseq Size | 3568 |
Refseq ORF | 1197 |
Synonyms | bA59I9.3; C6orf210; COQ1B; COQ10D3; DLP1; hDLP1 |
Summary | The protein encoded by this gene is an enzyme that synthesizes the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. Defects in this gene are a cause of coenzyme Q10 deficiency.[provided by RefSeq, Oct 2009] |
Protein Pathways | Terpenoid backbone biosynthesis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412512 | PDSS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412512 | Transient overexpression lysate of prenyl (decaprenyl) diphosphate synthase, subunit 2 (PDSS2) |
USD 325.00 |
|
PH307892 | PDSS2 MS Standard C13 and N15-labeled recombinant protein (NP_065114) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review