Pentraxin 3 (PTX3) (NM_002852) Human Mass Spec Standard

CAT#: PH307922

PTX3 MS Standard C13 and N15-labeled recombinant protein (NP_002843)

Product Images

Coomassie blue staining of purified PTX3 protein (Cat# TP307922). The protein was produced from HEK293T cells transfected with PTX3 cDNA clone (Cat# RC207922) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207922
• Predicted MW: 41.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207922 representing NM_002852
  Red=Cloning site Green=Tags(s)
  
  MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCDCGQEHSEWDKLFIMLENSQMRE
  RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQ
  RPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSAC
  IWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGL
  TSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRE
  TGGAESCHIRGNIVGWGVTEIQPHGGAQYVS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002843
• RefSeq Size: 1908
• RefSeq ORF: 1143
• Synonyms: TNFAIP5; TSG-14
• Locus ID: 5806
• UniProt ID: P26022
• Cytogenetics: 3q25.32
• Summary: 'This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononuclear phagocytes. The protein promotes fibrocyte differentiation and is involved in regulating inflammation and complement activation. It also plays a role in angiogenesis and tissue remodeling. The protein serves as a biomarker for several inflammatory conditions. [provided by RefSeq, Jun 2016]'
• Protein Families: Secreted Protein