PGK2 (NM_138733) Human Mass Spec Standard

CAT#: PH307941

PGK2 MS Standard C13 and N15-labeled recombinant protein (NP_620061)

Product Images

Coomassie blue staining of purified PGK2 protein (Cat# TP307941). The protein was produced from HEK293T cells transfected with PGK2 cDNA clone (Cat# RC207941) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207941
• Predicted MW: 44.8 kDa
• Protein Sequence:
  Sequence Link

  >RC207941 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVLMSHLGRPDGV
  PMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLENLRFHVEEEGKGQDPSGKKI
  KAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPHKASGFLMKKELDYFAKALENPVRPFLA
  ILGGAKVADKIQLIKNMLDKVNEMIIGGGMAYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRI
  TFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAK
  GTKALMDEIVKATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620061
• RefSeq Size: 1721
• RefSeq ORF: 1251
• Synonyms: dJ417L20.2; HEL-S-272; PGKB; PGKPS
• Locus ID: 5232
• UniProt ID: P07205, A0A140VJR3
• Cytogenetics: 6p12.3
• Summary: 'This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catalyzes the reversible conversion of 1,3-bisphosphoglycerate to 3-phosphoglycerate, during the Embden-Meyerhof-Parnas pathway of glycolysis, in the later stages of spermatogenesis.[provided by RefSeq, May 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways