CSNK1G3 (NM_001031812) Human Mass Spec Standard

CAT#: PH307965

CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001026982)

Product Images

Coomassie blue staining of purified CSNK1G3 protein (Cat# TP307965). The protein was produced from HEK293T cells transfected with CSNK1G3 cDNA clone (Cat# RC207965) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207965
• Predicted MW: 48.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207965 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA
  IKLEPMKSRAPQLHLEYRFYEQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL
  MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFGLAKEYIDPETKKHIPYREHKSLT
  GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF
  PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH
  QHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETNCQKVLNMWCCCFFKRRKRKTIQ
  RHK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001026982
• RefSeq Size: 4651
• RefSeq ORF: 1269
• Synonyms: CKI-gamma 3; CSNK1G3L
• Locus ID: 1456
• UniProt ID: Q9Y6M4
• Cytogenetics: 5q23.2
• Summary: 'This gene encodes a member of a family of serine/threonine protein kinases that phosphorylate caseins and other acidic proteins. A related protein in the African clawed frog participates in the transmission of Wnt/beta-catenin signaling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]'
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Hedgehog signaling pathway