SPG20 (NM_015087) Human Mass Spec Standard
CAT#: PH307971
SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_055902)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207971 |
Predicted MW | 72.9 kDa |
Protein Sequence |
>RC207971 protein sequence
Red=Cloning site Green=Tags(s) MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTG WESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAE VNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPP LETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVP DRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI PGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELHEWS EKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKV SQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMVVAASSVQGFSTVWQGLECAA KCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQI VDNSQRENQEGAANVNVRGEKDEQTKEVKEAKKKDK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055902 |
RefSeq Size | 5031 |
RefSeq ORF | 1998 |
Synonyms | SPG20; TAHCCP1 |
Locus ID | 23111 |
UniProt ID | Q8N0X7, A0A024RDV9 |
Cytogenetics | 13q13.3 |
Summary | This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified. Mutations associated with this gene cause autosomal recessive spastic paraplegia 20 (Troyer syndrome). [provided by RefSeq, Nov 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402406 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428017 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC428018 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC428019 | SPG20 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY402406 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1 |
USD 396.00 |
|
LY428017 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4 |
USD 605.00 |
|
LY428018 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3 |
USD 605.00 |
|
LY428019 | Transient overexpression lysate of spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2 |
USD 605.00 |
|
PH327155 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135766) |
USD 2,055.00 |
|
PH327162 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135767) |
USD 2,055.00 |
|
PH327169 | SPG20 MS Standard C13 and N15-labeled recombinant protein (NP_001135768) |
USD 2,055.00 |
|
TP307971 | Recombinant protein of human spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 1 |
USD 867.00 |
|
TP327155 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 4 |
USD 748.00 |
|
TP327162 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 3 |
USD 748.00 |
|
TP327169 | Purified recombinant protein of Homo sapiens spastic paraplegia 20 (Troyer syndrome) (SPG20), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review