GAA (NM_001079804) Human Mass Spec Standard
CAT#: PH308033
GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073272)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208033 |
Predicted MW | 105.3 kDa |
Protein Sequence |
>RC208033 protein sequence
Red=Cloning site Green=Tags(s) MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQA HPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLEN LSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYS VEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWN RDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSV VQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDF TNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICAS SHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPE ILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALT LRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLG TWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVA TAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001073272 |
RefSeq Size | 3517 |
RefSeq ORF | 2856 |
Synonyms | LYAG |
Locus ID | 2548 |
UniProt ID | P10253 |
Cytogenetics | 17q25.3 |
Summary | 'This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]' |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Galactose metabolism, Lysosome, Metabolic pathways, Starch and sucrose metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400052 | GAA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421540 | GAA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421541 | GAA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425893 | GAA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400052 | Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 1 |
USD 396.00 |
|
LY421540 | Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 2 |
USD 605.00 |
|
LY421541 | Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3 |
USD 396.00 |
|
LY425893 | Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3 |
USD 605.00 |
|
PH315796 | GAA MS Standard C13 and N15-labeled recombinant protein (NP_000143) |
USD 2,055.00 |
|
PH315840 | GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073271) |
USD 2,055.00 |
|
TP308033 | Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 3 |
USD 867.00 |
|
TP315796 | Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 1 |
USD 823.00 |
|
TP315840 | Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 2 |
USD 748.00 |
|
TP701073 | Purified recombinant protein of Human glucosidase, alpha, acid (GAA), with N-terminal His tag, secretory expressed in HEK293 cells, 20ug |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review