RALA (NM_005402) Human Mass Spec Standard

CAT#: PH308076

RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393)

Product Images

Coomassie blue staining of purified RALA protein (Cat# TP308076). The protein was produced from HEK293T cells transfected with RALA cDNA clone (Cat# RC208076) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208076
• Predicted MW: 23.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208076 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
  GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE
  EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005393
• RefSeq Size: 2828
• RefSeq ORF: 618
• Synonyms: RAL
• Locus ID: 5898
• UniProt ID: P11233
• Cytogenetics: 7p14.1
• Summary: 'The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Pancreatic cancer, Pathways in cancer