RALA (NM_005402) Human Recombinant Protein

CAT#: TP308076

Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA)

Product Images

Coomassie blue staining of purified RALA protein (Cat# TP308076). The protein was produced from HEK293T cells transfected with RALA cDNA clone (Cat# RC208076) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208076 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA
  GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE
  EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005393
• Locus ID: 5898
• UniProt ID: P11233
• Cytogenetics: 7p14.1
• Refseq Size: 2828
• Refseq ORF: 618
• Synonyms: HINCONS; RAL
• Summary: The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Pancreatic cancer, Pathways in cancer