B3GNT1 (B3GNT2) (NM_006577) Human Mass Spec Standard

CAT#: PH308100

B3GNT2 MS Standard C13 and N15-labeled recombinant protein (NP_006568)

Product Images

Coomassie blue staining of purified B3GNT2 protein (Cat# TP308100). The protein was produced from HEK293T cells transfected with B3GNT2 cDNA clone (Cat# RC208100) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208100
• Predicted MW: 46 kDa
• Protein Sequence:
  Sequence Link

  >RC208100 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQY
  NPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAK
  KPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILM
  WNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAG
  PHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKH
  KGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006568
• RefSeq Size: 2788
• RefSeq ORF: 1191
• Synonyms: 3-Gn-T1; 3-Gn-T2; B3GN-T2; B3GNT; B3GNT-2; B3GNT1; beta-1; beta3Gn-T1; beta3Gn-T2; BETA3GNT; BGnT-2; BGNT2
• Locus ID: 10678
• UniProt ID: Q9NY97
• Cytogenetics: 2p15
• Summary: This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2016]
• Protein Families: Transmembrane
• Protein Pathways: Glycosphingolipid biosynthesis - lacto and neolacto series, Keratan sulfate biosynthesis, Metabolic pathways