SLAP2 (SLA2) (NM_032214) Human Mass Spec Standard

CAT#: PH308103

SLA2 MS Standard C13 and N15-labeled recombinant protein (NP_115590)

Product Images

Coomassie blue staining of purified SLA2 protein (Cat# TP308103). The protein was produced from HEK293T cells transfected with SLA2 cDNA clone (Cat# RC208103) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208103
• Predicted MW: 28.6 kDa
• Protein Sequence:
  Sequence Link

  >RC208103 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWT
  VLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA
  SWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTV
  QRTPLNWKELDSSLLFSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115590
• RefSeq Size: 2569
• RefSeq ORF: 783
• Synonyms: C20orf156; MARS; SLAP-2; SLAP2
• Locus ID: 84174
• UniProt ID: Q9H6Q3
• Cytogenetics: 20q11.23
• Summary: This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors