SLAP2 (SLA2) (NM_032214) Human Recombinant Protein
CAT#: TP308103
Recombinant protein of human Src-like-adaptor 2 (SLA2), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208103 protein sequence
Red=Cloning site Green=Tags(s) MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWT VLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA SWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTV QRTPLNWKELDSSLLFSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115590 |
Locus ID | 84174 |
UniProt ID | Q9H6Q3 |
Cytogenetics | 20q11.23 |
Refseq Size | 2569 |
Refseq ORF | 783 |
Synonyms | C20orf156; MARS; SLAP-2; SLAP2 |
Summary | This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406314 | SLA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410277 | SLA2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406314 | Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 2 |
USD 396.00 |
|
LY410277 | Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 1 |
USD 396.00 |
|
PH308103 | SLA2 MS Standard C13 and N15-labeled recombinant protein (NP_115590) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review