DMRT1 (NM_021951) Human Mass Spec Standard

CAT#: PH308108

DMRT1 MS Standard C13 and N15-labeled recombinant protein (NP_068770)

Product Images

Coomassie blue staining of purified DMRT1 protein (Cat# TP308108). The protein was produced from HEK293T cells transfected with DMRT1 cDNA clone (Cat# RC208108) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208108
• Predicted MW: 39.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208108 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKS
  PRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLP
  SAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYY
  SSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN
  RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA
  VLECEPASEPSSFTVTPVIEEDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068770
• RefSeq Size: 2229
• RefSeq ORF: 1119
• Synonyms: CT154; DMT1
• Locus ID: 1761
• UniProt ID: Q9Y5R6
• Cytogenetics: 9p24.3
• Summary: 'This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transcription Factors