MSRB3 (NM_001031679) Human Mass Spec Standard
CAT#: PH308187
MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_001026849)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208187 |
Predicted MW | 20 kDa |
Protein Sequence |
>RC208187 protein sequence
Red=Cloning site Green=Tags(s) MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTH HKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFD DGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001026849 |
RefSeq Size | 4434 |
RefSeq ORF | 555 |
Synonyms | DFNB74 |
Locus ID | 253827 |
UniProt ID | Q8IXL7 |
Cytogenetics | 12q14.3 |
Summary | The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403694 | MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422222 | MSRB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403694 | Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 1 |
USD 396.00 |
|
LY422222 | Transient overexpression lysate of methionine sulfoxide reductase B3 (MSRB3), transcript variant 2 |
USD 396.00 |
|
PH316512 | MSRB3 MS Standard C13 and N15-labeled recombinant protein (NP_932346) |
USD 2,055.00 |
|
TP308187 | Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 2 |
USD 439.00 |
|
TP316512 | Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review