RNF11 (NM_014372) Human Mass Spec Standard

CAT#: PH308220

RNF11 MS Standard C13 and N15-labeled recombinant protein (NP_055187)

Product Images

Coomassie blue staining of purified RNF11 protein (Cat# TP308220). The protein was produced from HEK293T cells transfected with RNF11 cDNA clone (Cat# RC208220) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208220
• Predicted MW: 17.4 kDa
• Protein Sequence:
  Sequence Link

  >RC208220 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI
  AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM
  EPVDAALLSSYETN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055187
• RefSeq Size: 3082
• RefSeq ORF: 462
• Synonyms: CGI-123; SID1669
• Locus ID: 26994
• UniProt ID: Q9Y3C5
• Cytogenetics: 1p32.3
• Summary: The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome