JPH4 (NM_032452) Human Mass Spec Standard

CAT#: PH308221

JPH4 MS Standard C13 and N15-labeled recombinant protein (NP_115828)

Product Images

Coomassie blue staining of purified JPH4 protein (Cat# TP308221). The protein was produced from HEK293T cells transfected with JPH4 cDNA clone (Cat# RC208221) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208221
• Predicted MW: 65.7 kDa
• Protein Sequence:
  Sequence Link

  >RC208221 representing NM_032452
  Red=Cloning site Green=Tags(s)
  
  MSPGGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHSYQGHWQQGKR
  EGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGTETYSDGGTYQGQWQAGKRHG
  YGVRQSVPYHQAALLRSPRRTSLDSGHSDPPTPPPPLPLPGDEGGSPASGSRGGFVLAGPGDADGASSRK
  RTPAAGGFFRRSLLLSGLRAGGRRSSLGSKRGSLRSEVSSEVGSTGPPGSEASGPPAAAPPALIEGSATE
  VYAGEWRADRRSGFGVSQRSNGLRYEGEWLGNQRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLA
  LRRGKVKEKVDRAVEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPML
  EAPGRRPRQDSEGSDTEPLDEDSPGVYENGLTPSEGSPELPSSPASSRQPWRPPACRSPLPPGGDQGPFS
  SPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEEGEDEEPLPPLRAPA
  GTEPEPIAMLVLRGSSSRGHDAGCLTEELGEPAATERPAQPGAANPLVVGAVALLDLSLAFLFSQLLT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115828
• RefSeq Size: 4396
• RefSeq ORF: 1884
• Synonyms: JP4; JPHL1
• Locus ID: 84502
• UniProt ID: Q96JJ6
• Cytogenetics: 14q11.2
• Summary: This gene encodes a member of the junctophilin family of transmembrane proteins that are involved in the formation of the junctional membrane complexes between the plasma membrane and the endoplasmic/sarcoplasmic reticulum in excitable cells. The encoded protein contains a conserved N-terminal repeat region called the membrane occupation and recognition nexus sequence that is found in other members of the junctophilin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2009]