Alpha 1 microglobulin (AMBP) (NM_001633) Human Mass Spec Standard

CAT#: PH308342

AMBP MS Standard C13 and N15-labeled recombinant protein (NP_001624)

Product Images

Coomassie blue staining of purified AMBP protein (Cat# TP308342). The protein was produced from HEK293T cells transfected with AMBP cDNA clone (Cat# RC208342) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208342
• Predicted MW: 39 kDa
• Protein Sequence:
  Sequence Link

  >RC208342 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRSLGALLLLLSACLAVSAGPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVL
  GEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSR
  HHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQ
  EEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQT
  CRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRF
  SN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001624
• RefSeq Size: 1450
• RefSeq ORF: 1056
• Synonyms: A1M; EDC1; HCP; HI30; IATIL; ITI; ITIL; ITILC; UTI
• Locus ID: 259
• UniProt ID: P02760
• Cytogenetics: 9q32
• Summary: 'This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein