GLYCTK (NM_145262) Human Mass Spec Standard

CAT#: PH308348

GLYCTK MS Standard C13 and N15-labeled recombinant protein (NP_660305)

Product Images

Coomassie blue staining of purified GLYCTK protein (Cat# TP308348). The protein was produced from HEK293T cells transfected with GLYCTK cDNA clone (Cat# RC208348) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208348
• Predicted MW: 55.3 kDa
• Protein Sequence:
  Sequence Link

  >RC208348 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALSLDPGGRQLKV
  RDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAMERAGKQEMLLKPHSRVQVFE
  GAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQ
  ELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAAL
  PRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGL
  LAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG
  GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSH
  TFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660305
• RefSeq Size: 3798
• RefSeq ORF: 1569
• Synonyms: HBeAgBP4A; HBEBP2; HBEBP4
• Locus ID: 132158
• UniProt ID: Q8IVS8, A1LQE8
• Cytogenetics: 3p21.2
• Summary: This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
• Protein Families: Transcription Factors
• Protein Pathways: Glycerolipid metabolism, Glycine, serine and threonine metabolism, Glyoxylate and dicarboxylate metabolism, Metabolic pathways